PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013624958.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 651aa    MW: 72875.5 Da    PI: 5.5119
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013624958.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.95.6e-193682148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEde+l++av+ + g++Wk+Ia+++   Rt+ qc +rwqk+l
   XP_013624958.1 36 RGQWTAEEDEILKKAVHNFKGKNWKKIAEYFK-DRTDVQCLHRWQKVL 82
                     89*****************************9.************986 PP

2Myb_DNA-binding63.54e-2088134148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+ +v++++++G++ W+tIar+++ gR +kqc++rw+++l
   XP_013624958.1  88 KGPWTKEEDDMIVQLIQKYGPKKWSTIARYLP-GRIGKQCRERWHNHL 134
                      79******************************.*************97 PP

3Myb_DNA-binding42.71.3e-13140182145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+   + ++ gR+++ +k++w+
   XP_013624958.1 140 KEAWTQEEELVLIRAHQVYGNR-WAELTKFLP-GRSDNGIKNHWH 182
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.1523182IPR017930Myb domain
SuperFamilySSF466891.1E-183496IPR009057Homeodomain-like
SMARTSM007172.2E-153584IPR001005SANT/Myb domain
PfamPF002491.1E-163682IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-243897IPR009057Homeodomain-like
CDDcd001674.07E-143982No hitNo description
PROSITE profilePS5129432.27483138IPR017930Myb domain
SuperFamilySSF466891.87E-3185181IPR009057Homeodomain-like
SMARTSM007174.9E-1987136IPR001005SANT/Myb domain
PfamPF002493.0E-1888134IPR001005SANT/Myb domain
CDDcd001678.60E-1790134No hitNo description
Gene3DG3DSA:1.10.10.604.2E-2798142IPR009057Homeodomain-like
SMARTSM007174.0E-12139187IPR001005SANT/Myb domain
PROSITE profilePS5129417.977139189IPR017930Myb domain
PfamPF002491.1E-11140182IPR001005SANT/Myb domain
CDDcd001671.32E-9142182No hitNo description
Gene3DG3DSA:1.10.10.608.4E-20143189IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 651 aa     Download sequence    Send to blast
MESECATTPP PDGLTEGNPS KSRQGRTSGP TRRSTRGQWT AEEDEILKKA VHNFKGKNWK  60
KIAEYFKDRT DVQCLHRWQK VLNPELVKGP WTKEEDDMIV QLIQKYGPKK WSTIARYLPG  120
RIGKQCRERW HNHLNPAINK EAWTQEEELV LIRAHQVYGN RWAELTKFLP GRSDNGIKNH  180
WHSSVKKKLD SYMSSGLLDQ YQAMPLAPYD RNSFMQSTMD GSGCVSGQAE QEIEHGIMNM  240
GQHFHPCENS QYYYPELEDI SVSISEASYD MEDCSQFPDH NVSASTSQDY QFDFQDLSDI  300
SLEMSQNMSG LPMTYTKERK EASLGAPNSK SNIDVAAYTN TSETECCRVL FLDQESEGVS  360
VSRSSTQEPH EVLCASASDS QVSEATKSPM KSSSSMSIAT PASGKETLRP APLIITPDKY  420
SKKSSGLICH SFETNENGSF ICINDPSTST CVDEGPNNST EDYHLNDSKK LVPVNDFASL  480
AEAKPHSLPK HETNMSSEQH HEDMGASSSS LCFPSLDLPA FNDPVHDYSP LGIRKLLMSS  540
MACMSPLRLW ESPTGKKTLV GAKSILRKRT RDLLTPLSEK RSDKKLETDI AASLAKDFSR  600
LDVMFDESEN QESISGMPEE TMDVSKSLVQ PQQTCLEANV QHVSLVFPLS I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C8e-71361896159MYB PROTO-ONCOGENE PROTEIN
1h88_C8e-71361896159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719750.0AF371975.2 Arabidopsis thaliana putative c-myb-like transcription factor MYB3R-4 (MYB3R4) mRNA, complete cds.
GenBankAY5196500.0AY519650.1 Arabidopsis thaliana MYB transcription factor (At5g11510) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013624958.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLA0A0D3BMH40.0A0A0D3BMH4_BRAOL; Uncharacterized protein
STRINGBra008956.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132131828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.10.0myb domain protein 3r-4